Total number of results for Petromyzon marinus are 12
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP01234 |
MPPKPDNPSPDASPELSKYMLAVRNYINLITRQRY
|
35 | Petromyzon marinus | FMRFamide related peptide | Peptide methionine-tyrosine | 2070789#Conlon JM, Bjørnholm B, Jørgensen FS, Youson JH, Schwartz TW#Primary structure and conformational analysis of peptide methionine-tyrosine, a peptide related to neuropeptide Y and peptide YY isolated from lamprey intestine#Eur J Biochem 1991 Jul 15;199(2):293-8 | |
| NP02411 |
HSEGTFTSDYSKYLENKQAKDFVRWLMNA
|
29 | Petromyzon marinus | Glucagon | Glucagon-1 | 8405897#Conlon J.M., Nielsen P.F., Youson J.H.#Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.# Gen. Comp. Endocrinol. 91:96-104(1993). | |
| NP02412 |
HADGTFTNDMTSYLDAKAARDFVSWLARSDKS
|
32 | Petromyzon marinus | Glucagon | Glucagon-like peptide 1-I | 8405897#Conlon J.M., Nielsen P.F., Youson J.H.#Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.# Gen. Comp. Endocrinol. 91:96-104(1993). | |
| NP02413 |
HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
|
31 | Petromyzon marinus | Glucagon | Glucagon-like peptide 2-I (By similarity) | ||
| NP02414 |
HSQGSFTSDYSKHLDVKQAKDFVTWLLNT
|
29 | Petromyzon marinus | Glucagon | Glucagon-2 | ||
| NP02415 |
HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG
|
32 | Petromyzon marinus | Glucagon | Glucagon-like peptide 2-II | ||
| NP02537 |
HWSHDWKPG
|
9 | Petromyzon marinus | GnRH | GnRH-III | 17254668#Mezo G, Czajlik A, Manea M, Jakab A, Farkas V, Majer Z, Vass E, Bodor A, Kapuvári B, Boldizsár M, Vincze B, Csuka O, Kovács M, Przybylski M, Perczel A, Hudecz F#Structure, enzymatic stability and antitumor activity of sea lamprey GnRH-III and its dimer derivatives#Peptides 2007 Apr;28(4):806-20 | |
| NP04202 |
NPELYQMNHFRWGQPPTHF
|
19 | Petromyzon marinus | Opioid | MSH-A | 8537171#Takahashi A, Amemiya Y, Nozaki M, Sower SA, Joss J, Gorbman A, Kawauchi H#Isolation and characterization of melanotropins from lamprey pituitary glands#Int J Pept Protein Res 1995 Sep-Oct;46(3-4):197-204 | |
| NP04203 |
VQESADGYRMQHFRWGQPLP
|
20 | Petromyzon marinus | Opioid | MSH-B | 8537171#Takahashi A, Amemiya Y, Nozaki M, Sower SA, Joss J, Gorbman A, Kawauchi H#Isolation and characterization of melanotropins from lamprey pituitary glands#Int J Pept Protein Res 1995 Sep-Oct;46(3-4):197-204 | |
| NP05370 |
ALRAAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC
|
37 | Petromyzon marinus | Somastostatin | Somatostatin | 2902094#Andrews PC, Pollock HG, Elliott WM, Youson JH, Plisetskaya EM#Isolation and characterization of a variant somatostatin-14 and two related somatostatins of 34 and 37 residues from lamprey (Petromyzon marinus)#J Biol Chem 1988 Oct 25;263(30):15809-14 | |
| NP05383 |
AGCKNFFWKTFSSC
|
14 | Petromyzon marinus | Somastostatin | Somatostatin-14 | 2902094#Andrews PC, Pollock HG, Elliott WM, Youson JH, Plisetskaya EM#Isolation and characterization of a variant somatostatin-14 and two related somatostatins of 34 and 37 residues from lamprey (Petromyzon marinus)#J Biol Chem 1988 Oct 25;263(30):15809-14 | |
| NP05537 |
RKPHPKEFVGLM
|
12 | Petromyzon marinus | Tachykinin | Tachykinin | 8015973#Waugh D, Sower S, Bjenning C, Conlon JM#Novel tachykinins from the brain of the sea lamprey, Petromyzon marinus, and the skate, Raja rhina#Peptides 1994 Jan;15(1):155-61 |